kostenloser Webspace werbefrei: lima-city


Suche auf lima-city

  • in: Nummer in Textfeld überprüfen

    geschrieben von xasa

    Hallo

    also hab ich dich richtig verstanden, dass das Prinzip das gleiche ist wie bei Coca-Cola, wo man beim Kauf einer Cola einen Code erhält?
    gibt es dann nur 1 richtiges Code oder mehrere?

    mfg

    xasa
  • in: Wie baue ich ein Modell?

    geschrieben von xasa

    Ich denke auch, dass diese Steinchen dann zu teuer werden.

    Eine andere Alternative, die ich gehört habe, wäre Styropor. Kennt sich da jemand aus? Kann mir da jemand helfen? Denn als ich "Styropor" gehört habe, sind mir nur diese grossen Teilchen in Sinn gekommen, die bei Lieferpaketen dabei sind. Aber wäre das nicht zuu instabil? wie könnte man denn daraus ein Modell bauen? Ich kann mir das gar nicht vorstellen. :confused::confused::confused::confused:

    Ich hoffe ihr könnt mir weiterhelfen.

    mfg

    xasa
  • in: Wie baue ich ein Modell?

    geschrieben von xasa

    Naja... Lego gefällt mir nicht wirklich ;-)

    Pappmaschee finde ich ist zu "billig" und es entspricht nich eher meinem Geschmack. Das ganze ist (ich habe das glaube ich nicht erwähnt) ein Schulprojekt, und Pappmaschee ist dann schon unter meinem Niveau.

    Gasbeton wird zuu kompliziert, und es ist auch irgendwie schwer. Ich habe noch nie mit Gasbeton gearbeitet.

    Ich habe mir es mal überlegt, ob ich es doch aus Holz machen sollte. Es sieht auch (für mich) besser aus und ist auch leichter zum bearbeiten. Könnt ihr mir zu Holz irgednwelche tipps geben??? (bsp. welches Holz etc.)

    Danke
  • in: Wie baue ich ein Modell?

    geschrieben von xasa

    nei... 1:100 ist ok. Ich habe mir das gut genug überlegt, denn ich baue ja nicht mit dem Garten etc. es soll nur das Mausoleum sein, d.h. die Gesamtgrösse beträgt etwa 1m*1m*0.67m. :)
  • in: Wie baue ich ein Modell?

    geschrieben von xasa

    Hallo Zusammen :wave:

    Ich wollte fragen ob ihr mir irgendwelche Ratschläge zum folgendem Problem geben könnt:

    Ich will ein 1:100 Modell vom Taj Mahal bauen :) aber leider weiss ich nicht genau, wie ich das angehen soll :confused:

    Ich weiss nicht genau aus welchem Material ich das bauen soll (es gab schon einige, die haben gesagt ich sollte es aus Holz machen, andere aus Ton, wobei ich das nicht so eine gute Idee finde).

    Auch weiss ich nicht, obwohl ich längst nicht so weit bin, wie ich die Kuppel bauen sollte :S. Jemand hat vorgeschlagen, ich sollte es mit unterschiedlich langen rechtecken bauen. aber das problem ist, dass ich die Kuppel rund haben will, und nicht eckig oder kantig.

    Ich hoffe ihr könnt mir weiter helfen!

    Ich freue mich schon auf eure Antworten, und bedanke mich im voraus für eure Hilfe

    mfg

    xasa
  • in: charles baudelaire, la musique

    geschrieben von xasa

    Hi There

    Ich habe ein kleines Problem, es geht um ein Gedicht von Charles Baudelaire nämlich "La musique". Ich muss bei diesem Gedicht die Form des Gedichtes und eine analyse des inhaltes. Leider bin ich nicht ein Genie im Fach Französisch und ich habe vergebens im internet gesucht, aber leider nichts gescheites gefunden. Z.B. habe ich vor 2 Tagen eine Seite gefunden, die meiner meinung nach gute informationen enthält (über das design und dem programmieren kann man sich allerdings streiten), aber es hat sich herausgestellt, dass diese seite nicht vertrauenswürdig ist, da einige informationen falsch sind.

    http://www.bacdefrancais.net/musique.php

    Ich hoffe ihr könnt mir andere gute Seiten angeben, die ich brauchen könnte

    mfg

    xasa
  • in: Modelle kaufen

    geschrieben von xasa

    telelo schrieb:
    Ich meine z..B. das du nach "H0 Modelle shop" suchen könntest aber das hat bei mir nicht wirklich brauchbare Ergebnisse geliefert.:-(
    So jetzt habe ich aber den richtigen Suchbegriff! http://tinyurl.com/cdprk9
    Hoffe ich kann helfen:thumb:
    telelo


    Ich denke mal, das war keine schlechte idee, doch ich habe keine seite gefunden, wo sie modelle von "nicht-autos" verkaufen
    aber danke

    mfg
  • in: Modelle kaufen

    geschrieben von xasa

    strange schrieb:
    Selber bauen... nen bisschen Plastikkarton und Gedult. Nen paar Fotos und dann einfach machen. Fertig bekommt man sowas nur recht schwer.

    Und wenn Du mit dem Eifelturm fertig bist, machst mir nen Resinabguss :P


    naja, zum selber solche modelle bauen finde ich schlicht und einfach keine zeit dafür, deshalb habe ich au nachgefragt.

    telelo schrieb: Du wirst leichter etwas finden wenn du mit Maßstäben wie H0, Z oder so suchst!
    :thumb:


    wie meinst du das? kannst du mir vielleicht ein beispiel geben?
  • in: Modelle kaufen

    geschrieben von xasa

    Hey Leute

    Ich interessiere mich sehr für Modelle und wollte euch fragen ob ihr eine Seite kennt, wo man zu angemessenen preisen beispielsweise ein Modell vom Taj Mahal oder Eiffelturm etc. kaufen kann. Von der Grösse sollte es vielleicht etwa 10 cm * 10 cm *15 cm (beim eiffelturm etwas kleinere länge und breite)
    ich habe mal im internet gesucht und war nicht sehr erfolgreich... allerdings habe ich ein "beispielbild" gefunden von einem Legomodell. Ich möchte aber kein legomodell.

    http://i.dailymail.co.uk/i/pix/2008/08/21/article-1047657-025DA06500000578-355_468x366.jpg

    ich hoffe ihr könnt mir weiter helfen.

    mfg

    xasa
  • in: Software zum Modelle konstruieren

    geschrieben von xasa

    hey leute

    also ich danke euch schon mal für eure Hilfe

    Ich denke auch nicht, dass ein Programm mit statischen Berechnungen zu haben ist (wenn, dann recht teuer)

    Ausserdem habe ich noch etwas vergessen: Ich arbeite mit einem Mac 10.4.11 Tiger!! ich weiss nicht ob das ein Vorteil/Nachteil ist. es ist auch nicht ausgeschlossen, dass ich mit einem Windows PC arbeite, wenn es besser wäre als mit einem mac zu arbeiten.

    Vielleicht gibt es ja exklusive Software für mac.

    Ich hoffe ihr könnt mir noch irgendwelche Tipps oder alternativen geben.

    Danke

    mfg
    xasa
  • in: Software zum Modelle konstruieren

    geschrieben von xasa

    Hi Leute

    Ich habe mal eine Frage: Ich möchte als Semesterarbeit ein Gebäude konstruieren und ein Modell davon machen. Nun ich habe mich mal mit meiner Betreuungsperson abgesprochen und sie hat mir gesagt, es gibt ein Software/ Programm, mit denen man Modelle konstruieren kann. Ich suche eine solche Software, die mir helfen kann ein Modell zu konstruieren und mir auch bei der Statik hilft, also ob das Gebäude stabil ist, wie stark man es belasten kan, ob es weitere stützen braucht, etc...

    Gibt es ein solches Programm? Ich wäre euch dankbar, wenn ihr mir helfen könntet. Ausserdem bevorzuge ich freeware, aber wenn es keine kostenlose Software gibt, bin ich bereit, bis zu einem angemessenen Preis zu bezahlen, da ich dieses Programm dann nicht nur für meine Semesterarbeit brauchen werde.

    Ich danke schon im voraus :-)

    mfg

    xasa
  • in: Thema: Versuchung. Bild?

    geschrieben von xasa

    Also ich habe jetzt schon einiges gehört, aber das ist ja nicht alles, was ich wissen wollte...ein teil meines problems ist es ja auch, was für bilder ich zeichnen sollte???

    aber bisher gute Ideen, Danke! :)
  • in: Thema: Versuchung. Bild?

    geschrieben von xasa

    Hi Leute

    Ich habe ein kleines Problem:

    Ich habe ein Thema vorgegeben (Thema: Versuchung) und ich muss 5 zeichnungen dazu machen. Nur leider habe ich keinen blassen, was ich machen soll und wie ich das angehen soll...deshalb frage ich euch:

    Welche Assoziationen und Ideen habt ihr zu dem Thema und was für zeichnungen würdet ihr machen?

    Ich hoffe die frage ist klar, ansonsten einfach nachfragen

    Danke schon im voraus

    mfg

    xasa
  • in: Excel

    geschrieben von xasa

    Ich habe bis jetzt gute vorschläge gehört und ich werde sie versuchen umzusetzen, wenn das möglich ist.
    ich melde mich wieder, falls es nicht klappen würde
  • in: Excel

    geschrieben von xasa

    Hey Leute, ich habe ein kleines Problem mit Excel.
    Ich habe versucht eine kleine Datenbank zu machen, aber irgendwie komme ich nicht ganz draus mit den funktionen. ich habe überall nachgeschaut wo man kann aber erfolgslos. Mein Problem ist die folgende:
    Ich habe eine Tabelle, eine sogenannte Punkteverteilungstabelle:

    Sehr gut: 5
    Gut: 4
    Genügend: 3
    schlecht: 2
    sehr schlecht 1

    und ich möchte eine andere Tabelle machen indem ich in einer linken Zelle den Namen einer Person schreibe (z.b. Bob) und rechts sehr gut, gut, genügend, schlecht oder sehr schlecht. und eine zelle weiter soll ich mit einer funktion schaffen, dass er entsprechend der leistung (sehr gut, gut, genügend, schlecht oder sehr schlecht) Punkte verteilt.
    Beispiel:
    Bob

    gut

    4
    die entsprechende punktzahl soll der Computer dank einer funktion selber reinschreiben.
    könnt ihr mir vielleicht die funktionsformel für die 3. zelle geben?

    Ich hoffe ihr versteht mein Problem und könnt mir helfen.
    Ich danke schon im voraus

    mfG
    xasa :cool:


    Beitrag geändert: 13.7.2008 16:26:02 von xasa
  • in: Börsenspiel

    geschrieben von xasa

    danke ... auf die seite binich gar nicht gestossen..*oops!*

    :cool:piis
  • in: Börsenspiel

    geschrieben von xasa

    Hallo Leute

    Wollte fragen ob ihr nicht vielleicht kostenlose Börsenspiele kennt, die man au online spielen kann..

    Danke schon im voraus

    Piis
  • in: UHR

    geschrieben von xasa

    tut mir leid, dass ich so lange nicht geantwortet habe.. war mit anderen dingen beschäftigt:
    nun, ich weiss nicht, wie man diese dateien einbindet.
  • in: Eine EIN-WORT Geschichte:

    geschrieben von xasa

    Eines regnerischen Spätnachmittagfrühsommertages kam Tina nach Hinterhuglhapfing, wo etwas böses versuchte, ihr den Schrecken zu Rauben. Doch dann öffnete plötzlich jemand seine Hose und schloss sie mit verbundenen Ohren, um nichts falsch zu machen. Es war inzwischen dunkel wegen dem Stromausfall, der ganz plötzlich Tina überraschte und sie fühlte, dass auf der Schulter eine Eule ihr Unwesen trieb. China kopiert mit Doublelayerbrennern die Vista Benutzeroberfläche, welche nicht hässlich aber rund ist. Tina erkundigt sich nun erstmal, ob Chinesen gesundes Obst vertragen. Die Tina gestikulierte wild, sah etwas komisches, einen Lötkolben, welcher sehr heiß mitten in der Butter lag. Gullideckel sind alle schwer, obwohl sie komischerweise rund sind. Tina geht anschaffen, was dumm aussieht, denn sie hat zu wenig von ihrer Pille eingenommen, die war einfach zu kurz um etwas anderes zu machen. Manchmal hat frau einfach nicht das richtige Essen dabei. Später kauft Tina einen Hamburger mit Pommes bei dem sie kotzen muss. Dann fühlte der Donaudampfschiffsatelitenueberwachungssystemstellvertreterkapitaen einen Kotzfleck grausam zwischen seinen nichtvorhandenen Stück. Er warf Tina vor allem Ketzerei und vieles mehr vor. Doch dann kam Gunter der Doofe. Er triefte jämmerlich vor Notgeilheit und
    wollte sie ganz für sich haben. Dann furzte Tina ganz erbärmlich unmelodisch in seine hässliche Fresse. Er hatte 10 Jahre alte Sackhaare am start welche letztendlich dafür verantwortlich waren, dass
  • in: längste thread

    geschrieben von xasa

    schaffen wir schon
  • in: Rush Hour 3

    geschrieben von xasa

    ich habe rush hour 3 auch gesehen.
    ich fand ihn einfach geil und very funny!:biggrin:
    also, es lohnt sich mal dafür ins kino zu gehen.
  • in: Welchen HTML Editor benutzt ihr?

    geschrieben von xasa

    ich weiss nicht ob das schon erwähnt wurde, aber ich würde dir textwrangler empfehlen.
    ist sehr gut, allerdings kostet es etwas.
  • in: garageband

    geschrieben von xasa

    .band dateien glaube ich..
    aber ich habe das problem jetzt gelöst.
    Dieses thema kann geschlossen werden.
  • in: garageband

    geschrieben von xasa

    hey leute
    Ich habe ein dringendes wichtiges problem:
    Ich habe mit garageband ein paar beats gemacht, und möchte sie so convertieren, dass ich sie mit itunes öffnen kann. Natürlich basiert dieses Problem auf Mac Os X.
    Ich brauche es wirklich dringend.
    mfG
    xasa :cool:
  • in: UHR

    geschrieben von xasa

    Es ist keine Anleitung dabei und im internet habe ich nichts gefunden...
  • in: UHR

    geschrieben von xasa


    Hier gibts auch noch ne menge links für uhren mit java: http://www.pagetools.de/java-applets4/applets-uhren.html

    Danke für die Seite, noch sehr nützlich ^^
    Wie muss ich es aber machen, wenn ich die heruntergeladene Uhr auf eine HTML einfügen möchte?
  • in: UHR

    geschrieben von xasa

    Hey Leute

    Ich habe eine kleine Bitte an euch:
    Ich gestalte eine HP und ich möchte dort eine Uhr einbauen. Nur leider kenne ich mich nicht gut mit programmiersprachen aus und möchte euch fragen, ob ihr mir nicht eine uhr \"basteln\" könnnt, die ich direkt in meine seite einbauen kann...?

    mfG xasa :cool:
  • in: Wortspiel *alle mitmachen*

    geschrieben von xasa

    Relativitätstheorie -> KA!
  • in: Animationsprogramm für mac

    geschrieben von xasa

    Hallo Leute

    Ich weiss nicht, ob dieser Thread schon geöffnet wurde, aber ich habe bisher noch keinen gefunden:
    wie der Titel schon sagt, suche ich einen animationsprogramm für mac. Ich kenne schon animake :thumb:, aber es gibt ihn leider nicht für mac :(. Darum wollte ich von euch wissen, ob ihr nicht so einen guten animationsprogramm kennt. googlet habe ich auch schon, aber die auswahl ist zu gross. Ich will einen guten programm und das kann google nicht entscheiden.
    Am besten wäre es, wenn das programm den gleichen prinzip wie animake hat (nur bilder einfügen, und es macht automatischen eine animation).

    mfG xasa
  • in: Animationsprogramm für mac

    geschrieben von xasa

    Hallo Leute

    Ich weiss nicht, ob dieser Thread schon geöffnet wurde, aber ich habe bisher noch keinen gefunden:
    wie der Titel schon sagt, suche ich einen animationsprogramm für mac. Ich kenne schon animake :thumb:, aber es gibt ihn leider nicht für mac :(. Darum wollte ich von euch wissen, ob ihr nicht so einen guten animationsprogramm kennt. googlet habe ich auch schon, aber die auswahl ist zu gross. Ich will einen guten programm und das kann google nicht entscheiden.

    mfG xasa
  • in: Ich versage gerade in SQL....

    geschrieben von xasa

    noch eine bemerkung: es gibt ein befehl, der auf den bildschirm ausschreibt, was er gerade in die datenbanktabelle eintragen will. kombiniert mit dem "die-befehl" kann man herausfinden, ob es am eintragen liegt oder an der tabelle.
  • in: Kleiner Quellcode

    geschrieben von xasa

    ich muss mich den anderen anschliessen. wenn ein browser das erkennen würde, wäre es schon eine faszinatin würde ich mal meinen.
  • in: Meine HP-Eure Meinung

    geschrieben von xasa


    Aha...welchen browser....ich versteh das nicht...hat sonst irgendwer solche probleme?
    Es müsste alles recht schnell laden...hab das extra deswegen auf php include umgestellt!
    Kann das am server liegen? vielleicht an der at.vu-domain? Ist es so besser:
    http://aut29er.redio.de/
    lg

    Beitrag geändert: 23.7.2007 20:15:15 von aut229er


    also, ich hatte das problem auch. ich glaube weniger daran, dass es am .at.vu liegt. denn wenn du den link kopierst und in die adressleiste hineinkopierst dann geht's *ruck-zuck*.
    ;)
    noch zur seite. ich finde es nicht schlecht.

    Beitrag geändert: 23.7.2007 20:56:01 von xasa
  • in: Ich versage gerade in SQL....

    geschrieben von xasa

    ich nehme mal an, dass du die datenbank aufgerufen hast. also du hast mysql_query($sql). müsstest du nicht vor $sql die datenbank definieren?
  • in: chinese??

    geschrieben von xasa

    hallo leute

    ich habe nechstes schuljahr vor chinesisch zu lernen, nun wollte ich euch frage:
    würde sich das denn lohen?
    also ich denke schon. denn wenn du einmal chinesisch gelernt hast, kannst du mit etwa 1/5 der ganzen weltbevölkerung sprechen.
    ich wollte eure meinung mal wissen
  • in: caeser-script

    geschrieben von xasa



    trueweb schrieb:

    ich hab scho eine andere bessere lösung gefunde, darum darf dieser thread geschlossen werden!


    Wie ich diese Menschen liebe... Wie wärs mit ZUERST suchen und DANN fragen?


    ich habe gesucht...nix gefunden...dann gefragt und trotzdem noch gleichzeitig gesucht!!
  • in: caeser-script

    geschrieben von xasa

    ich hab scho eine andere bessere lösung gefunde, darum darf dieser thread geschlossen werden!
  • in: Wie viel Freizeit habt ihr?

    geschrieben von xasa

    Ich habe fast gar keine Freizeit...:(:(:(
  • in: caeser-script

    geschrieben von xasa

    Es funktioniert bei mir nicht. ich weiss den grund dafür auch nicht, aber es hat irgendetwas mit der function "rotate" zu tun.
    das kommt bei mir raus:
    Fatal error: Call to undefined function rotate()
    :confused::confused::confused::confused::confused::confused::confused::confused:
  • in: caeser-script

    geschrieben von xasa

    der artikel ist scho auf deutsch, aber die comments sind auf english...
  • in: caeser-script

    geschrieben von xasa

    ich verstehe nicht so gut english. vlt kann es mir jemand mal kurz übersetzen.
  • in: caeser-script

    geschrieben von xasa

    hey leuz

    ich wollte den caesercode mit PHP programmieren.
    und jetzt habe ich eine frage: gibt es eine function oder etwas, das schneller geht, den code zu proggen?

    ich hoffe ihr könnt mir helfen.
  • in: Design bearbeiten ?

    geschrieben von xasa

    ich würde dir textwrangler empfehlen. es kostet vlt ein bisschen aber es ist sehr gut und übersichtlich und sehr flexibel.
    es wird sogar mit farbe unterteilt und somit auch benutzerfreundlich ;).
  • in: Suche

    geschrieben von xasa



    zwiebeldoener schrieb:
    Bei mir funktioniert die Suche einwandfrei...


    bei mir auch! :biggrin:
  • in: primfaktorzerlegung

    geschrieben von xasa

    eine Alternative zum obigen Quelltext.

    <?php
    
    $a=100;
    $b=2;
    $i=0;
    print $a."= "; 
    while ($a>1)
    {
    	if(($a%$b)==0)
    	{
    		print $b."*";
    		$a=$a/$b;
    		$b=2;
    	}
    	else
    	
    	{
    		$b++;
    	}
    }
    
    ?>


    Man sieht dann auf dem Bildschirm: 100=2*2*5*5

    Ich will aber, dass es das schreibt: 100=2^2*5^2
  • in: primfaktorzerlegung

    geschrieben von xasa

    ja es soll mit PHP gemacht werden. Ich weiss, mit Basich gehts scho besser, aber diesmal ist PHP gefragt. Ich hoffe das geht auch;).
  • in: primfaktorzerlegung

    geschrieben von xasa

    hallo leute

    ich suche ein kleines Programm (soll nicht zu kompliziert sein und basierend auf PHP-Grundlagen), welches die Primfaktorzerlegung einer Zahl (Bsp: 100) elegant darstellt.
    Mit elegant meine ich, dass es falls es z.b. 2 mal 2 wäre, dass es "2 hoch 2" ausschreibt.
    Ach ja, und die Malpunkt könnt ihr mit "x" oder "." oder "," darstellen.

    Ich hoffe ihr könnt mir helfen.
    Ich krieg das nicht auf die Reihe, also wenns geht dann heute noch ;)!

    mfg
    xasa
    :cool:
  • in: ...

    geschrieben von xasa

    >>closed<<

    :biggrin::biggrin::biggrin::biggrin::biggrin::lol::lol::lol::lol:
  • in: Was war zuerst da? Das Ei oder das Huhn?

    geschrieben von xasa

    Ich würde sagen Ei, denn aus dem ei entwickelt sich ein huhn und das ei hat sich aus irgendwelchen anderen substanzen entwickelt
    mfg
    xasa
    :cool:
  • in: Was ist besser? PHP oder Java?

    geschrieben von xasa

    Ich schliesse mich ank an...Ich finde PHP besser und vorallem einfacher zu bedienen.
  • in: Animationen

    geschrieben von xasa



    starthtml schrieb:
    Wnn du mehrere GIF-Bilder hast und daraus eine Animation erstellen möchtest, kannst du das Programm AniMake verwenden (http://www.animake.de/). Damit schaltest du die Bilder hintereinander und speicherst sie als ein GIF Bild wieder ab ;)

    mit freundlichen Grüßen

    Simon


    Leider habe ich einen Mac os x und animake läuft darauf nich'...
  • in: Animationen

    geschrieben von xasa

    Gibt es eine Seite, in der es flash gut erklärt wird?
    wie z.b.PHP-->de.php.net
    oder auch html-->de.selfhtml.org
  • in: keynote

    geschrieben von xasa

    kommt schon leute, ich bin in stress!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
    Ich brauche die information dringend.!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!


    Beitrag geaendert: 16.5.2007 21:18:21 von xasa
  • in: Animationen

    geschrieben von xasa


    also
    1 Flash wäre ne möglichkeit


    Ich beherrsche bzw. kenne Flash nicht. gibt's da nich' ne alternative?


    2 bist du bereit für Programme was zu Zahlen?
    Kostenlos: Gimp bzw Blender
    Kostet: Photoshop bzw 3DsMax


    Ich will nicht nur einen einzigen Bild. Wie ich schon erwähnt habe, möchte ich einen animierten Banner haben.


    Oder du könntest einfach nur mehrere bilder hinternander mit z.B. abspielen


    Wie geht denn das?
  • in: Animationen

    geschrieben von xasa

    yo homies ;)

    Ich habe eine Homepage in Planung.
    Nun möchte ich nicht nur text bilder etc. reinbringen sondern auch Animationen und auch einen eigenen Banner.

    Frage1: Wie kann ich am besten und einfachsten Animationen herstellen. Programm, evtl Programmiersprache? Ach ja, ich kenne keine Sprache, die Animationen herstellt.

    Frage2: Wie kann ich einen eigenen Banner herstellen?

    Ich hoffe ich gehe euch nicht mit solche blöden Fragen :lol:
    auf die Nerven und könnt mir helfen.

    mfg
    euer homie
    xasa
  • in: keynote

    geschrieben von xasa

    hallo leute

    Ich wusste nicht wo ich diesen Thread plazieren sollte, also habe ich irgendwo plaziert...
    Ich wollte fragen ob sich hier jemand mit keynote auskennt.
    Ich habe nämlich ein OsX und benutze nicht powerpoint sondern Keynote.
    Ich mache eine Präsentation über ein Lied, und ich wollte ebenfalls auch die den Text dazu zeigen.
    Frage: Wie kann ich es so einstellen, dass das Lied läuft und dazu gleichzeitig auch die Lyrics (natürlich immer an der richtigen Stelle; es darf sich aber auch ein paar sek. verzägern, hauptsache, dass es niemandem auffält.

    Ich hoffe, ihr habt mich verstanden und könnt mir helfen.

    mfg
    xasa
    :cool:
  • in: übersetzung

    geschrieben von xasa

    hallo leute

    kann mir mal jemand eine seite zeigen wo die übersetzung von französischen Liedtexte sind.

    (info: ich suche die übersetzung von "oublie moi" von shy'm)

    hoffe ihr könnt mir helfen

    mfg
    xasa
    :cool:
  • in: Cheats

    geschrieben von xasa

    bei den meisten Spielen die du (generell) kaufst, ist auch ein Ordner mit dabei die dateien beinhalten. So z.B. AOE III. oder sonst noch andere Spiele.
    Ich will jetzt nicht werbung dafür machen aber: Man kann damit z.b. die Bevölkerunglimit hochsetzen (Da würde ich aufpassen, wenn du nicht einen guten Prozessor und mind.1GB Ram hast geht's schlecht bzw. der computer stürzt ab! xD) oder mehr Anfangsressourcen haben.
    Meistens sind die Quelltexte recht simpel, aber eben nur für einen Programmierer (auch z.t Anfänger).

    Ob du das jetzt Cheats nennst, kannst du ja selbst bestimmen. ;)


    mfg
    xasa
    :cool:

  • in: Array

    geschrieben von xasa

    das is' aber nicht php oda?
  • in: Array

    geschrieben von xasa

    und wo muss ich deinen quellcode in meinem einsetzen??
    kannst du mir dann noch den endquellcode reinkopieren. wäre sehr net.


    Beitrag geaendert: 12.5.2007 20:50:54 von xasa
  • in: Array

    geschrieben von xasa

    tut mir leid, aber ich verstehe den code nicht so direkt.
    vlt noch eine passende erklärung bitte...
  • in: Array

    geschrieben von xasa

    sry, hatte einfach mal lust dazu

    mein kleines programm dient dazu alle primzahlen zwischen 60 und 100 rauszufinden:
    <?php
    
    $n=60;
    while($n<=100)
    {
    $a=1;
    $arrTemp=array("");
    
    
    
    	
    	while($a<=60)
    		{
    			if(($n%$a)==0)
    	
    			{	
    			array_Push($arrTemp,"$a");
    			
    			}
    			$a++;
    		}
    		
    	
    		$i=count($arrTemp);
    		if ($i==2)
    			{
    				print $n;
    				print "<br>";
    				print " ist eine Primzahl";
    			}
    		else
    			{
    				print $n;
    				print "<br>";
    				print " ist keine Primzahl";
    			}	
    $n++;
    }
    ?>


    so schaut der code aus. und ich möchte rausfinden ob in $arrTemp ein Paar gibt, welche die Differenz zwei haben, also Primzahlzwillinge sind.
    hoffe du hast es jetzt verstanden.
    und wegen den fehlern, ich bim momentan zu müde um auf fehler zu achten.
    das nächste mal, behalte es.
    ich schenk sie dir :lol:
  • in: Array

    geschrieben von xasa

    hello guys

    ich habe ein kleines programm geschrieben und darin gibt es ein array, der ein paar zahlen speichert die ich benötige.
    Ma question à vous: wie kann ich bestimmen ob es ein paar (oder mehrere paare)
    nur 2 unterschiede haben? Denn der Differenz einiger zahlen beträgt nämlich 2 (ich weiss es, weil ich es normal nachgeprüft habe), aber ich weiss nicht wie ich es im programm prüfen sollte.

    ich hoffe ihr mir helfen and thanks for those who can aide moi.

    cya
  • in: Bewerten und frage

    geschrieben von xasa

    Ich finde das design nicht schlecht.
    Das Logo( oder banner; was auch immer) passt sehr gut zum design.

    Zu deiner Frage, kann ich dir leider nicht helfen, da ich nicht ein grafikgenie bin. sry

    mfg
    xasa
    :cool:
  • in: MySQL on mac

    geschrieben von xasa

    sry für den doppelpost, aber niemand antwortet auf meine frage?
    kann mir da nicht jemand helfen.
  • in: MySQL on mac

    geschrieben von xasa



    Dann gibt dort ein: mysql --user=BENUTZERNAME --password=PASSWORD
    ^
    /|\

    muss ich die 2 bindestriche auch machen?? |

    kann ich "BENUTZERNAME" & "PASSWORD" ersetzen durch was ich will???


    ach ja, dort gibt es eine auswahl, wenn ich auf downloads klicke...welchen soll ich nehmen?

    Beitrag geaendert: 8.5.2007 21:56:21 von xasa
  • in: MySQL on mac

    geschrieben von xasa

    hallo leute

    ich hab ne frage:

    Ich bin mittelmässiger programmierer im bereich PHP und MySQL. Dazu habe ich ein Mac OS X vers. 10.4.9.

    Mein Problem ist, dass ich MySQL gelernt habe und weiss nicht wie man es auf mac anwendet.
    Vlt. konkreter: Man braucht ja bei Windows "Eingabeaufforderung", wie geht das bei mac. Welche Unterschiede hat es bei den Befehlen.
    Ich habe jetzt ganz neu MySQL installiert und will anfangen eine Datenbank zu erstellen und Tabellen herstellen, wie geht das??

    Ich hoffe ihr könnt mir helfen.

    mfg
    xasa
    :cool:
  • in: design bewertung

    geschrieben von xasa

    stimmt schon! Mein Cousin arbeitet bei dieser firma und er hat das design mit anderen kollegen kreiert. ich hab einen kleinen teil dazu beigetragen.

    Ich hab auch nirgendwo erwähnt, dass ich es erstellt bzw. alleine erstellt habe oda?????
    Ausserdem habe ich es noch mehr verändert


    Beitrag geaendert: 7.5.2007 18:55:12 von xasa
  • in: design bewertung

    geschrieben von xasa

    danke für den tipp, möchte gerne weitere kommentare hören
  • in: design bewertung

    geschrieben von xasa

    du hättest einfach auf mein profil gehen sollen und dort wäre es auch (der link)

    aber hier: http://xasa.lima-city.de

    Beitrag geaendert: 7.5.2007 18:29:30 von xasa
  • in: Vorzung/Vernachlässigung durch krama

    geschrieben von xasa

    also, vielleicht liegts nicht am karma sonder wegen den fragen oder so.
    Denn vielleicht gibt es leute, die rumspammen und einfach so aus spass - karma vergeben ( nur zur info: ich gehöre nich dazu), dann hat man einfach pech gehabt, und das ist auch was du sagen willst.

    Es gibt sogar Users (ich hab mal einen angetroffen) die schreiben z.b folgendes: Gebt mir - karma.

    Fazit: Alle sollen mehr oder weniger gleich behandelt werden.

    P.S: Das war ja auch ein schneller Antwort. ;)

    Piis
  • in: design bewertung

    geschrieben von xasa

    könntet ihr bitte das design bewerten. ob + oder - ist egal...einfach kommentare hinweise, tipps etc.

    ich danke schon im voraus
  • in: Kann man einen MP3-Player tunen?

    geschrieben von xasa

    ich glaube schon, dass das geht! ;)
  • in: Diamantfoto

    geschrieben von xasa



    tof-devil schrieb:
    Du machst mit Photoshop 3 Ebenen, in der obersten und untersten jeweils den Diamanten (ein wenig Transparent) und die Ebene in der mitte erhält die Person. Fertig!

    Beispiel Diamant mit Ipod Person...
    Link:
    http://img352.imageshack.us/img352/8224/diamantpersonwq8.jpg

    MfG tof-devil

    Beitrag geaendert: 30.4.2007 19:47:56 von tof-devil


    hat nich geklappt...
    vielleicht irgendwelche speziellen einstellungen, die ich berücksichtigen sollte??
  • in: Diamantfoto

    geschrieben von xasa

    der sinn dieses threads is es dass ich dann am schluss weiss, wie das gehen soll, falls ich das mal irgendwann brauchen könnte.


    kann mir sonst niemand helfen????????:confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused::confused:
  • in: Diamantfoto

    geschrieben von xasa

    hey ich hab ein problem:

    Es geht um dieses Bild:http://www.diamondvues.com/archives/starofafrica3.jpg

    ich hab ein foto, von einer person und ich will es so einbauen, dass es so aussieht als ob die person in den diamanten drinnen ist.

    Infos:

    ich benutze photoshop elements 2.0. wäre schön wenn ihr es mir mit dem erklären könntet.


    ------------------

    falls ihr es nicht versteht meldet einfach.

    hoffe ihr könnt mir helfen ;)

    mfg

    xasa
    :cool:
  • in: banner-logo

    geschrieben von xasa

    danke!!

    dieses thread kann geschlossen werden.

    piis
  • in: Wie Findet ihr cheater?

    geschrieben von xasa

    ich hab mal so ne frage...benutzt du cheats?????
  • in: banner-logo

    geschrieben von xasa

    danke
    ...und wie kann man ein banner von anderen seiten auf die eigene seite bringen??


    Beitrag geaendert: 29.4.2007 12:39:40 von xasa
  • in: banner-logo

    geschrieben von xasa

    hey leute

    was isn der unterschied zwischen logo und banner...??
    welches ist am besten geeignet für eine website??
  • in: Neues Design erstellt

    geschrieben von xasa

    versuchs mal mit ein bisschen mehr rot oder grün...
  • in: farbverlauf

    geschrieben von xasa



    sandrock-jonas schrieb:
    ... Ansonsten kannst du auch direkt mit GIMP Farbverläufe erstellen. GIMP ist im Gegensatz zu Photoshop Freeware.



    und wie geht das genau...ich kenn mich nicht mit gimp aus...
  • in: farbverlauf

    geschrieben von xasa

    danke...ich werds versuchen

    EDIT (by thoba): Doppelpost gelöscht. 2. Posting:



    .. rechtsklick druff komt ne liste...


    kann man ja gar nicht (rechtsklick)!!

    Beitrag geaendert: 27.4.2007 15:17:09 von thoba
  • in: farbverlauf

    geschrieben von xasa



    phyroad schrieb:
    Wenn es schnell gehen sollte habe ich das hier benutzt und hat auch ganz gut geklappt: http://www.homepage-total.de/tools/farbverlauf_html.php


    wenn ich den farbverlauf erstellt habe, wie kann ich es als bild speichern???
  • in: farbverlauf

    geschrieben von xasa

    ich benutze photoshop elements 2.0

    ich weiss aber nicht welchen tool du meinst..dude!

  • in: farbverlauf

    geschrieben von xasa

    hey leuz

    ich wollte fragen, wie ich selber einen farbverlauf herstellen bzw. kreieren kann.

    mfg
    xasa
    :cool:
  • in: n, the way of the ninja

    geschrieben von xasa

    aber der selbsttötungseffekt kann man ja beim online spiel nicht machen oda? das geht doch nur wenn man es herunterlädt...
  • in: n, the way of the ninja

    geschrieben von xasa

    hey leute

    Ich habe mal im playit einen voll coolen game gefunden
    und wollte sehen, wieviele leute sich für das game interessieren.
    Das Spiel heisst: "n, the way of the ninja" aber es wird meistens nur als
    "n" geschrieben.
    Es ist ein lustiges Jump 'n run spiel und macht einem auf eine irgendeine
    weise "süchtig"!!!:lol::lol::lol::lol::lol::lol::lol:

    ich weiss ja nicht, probiert es doch auch mal aus!!

    mfg
    xasa
    :cool:


    Beitrag geaendert: 23.4.2007 20:32:11 von xasa
  • in: beatmaker 4 mac

    geschrieben von xasa

    danke für deine hilfe

    Ich werde mal etwas über 'logic' rauskriegen.

    mfg

    xasa

    :cool:
  • in: Im'ma shine

    geschrieben von xasa

    ich brauche einfach die noten zum beat vom hauptinstrument
  • in: Im'ma shine

    geschrieben von xasa

    Hey leute
    Können mir die Leute helfen die folgendes Lied kennen. Es heisst Im'ma shine.
    Es ist ein Hip-Hop Lied. Was mich sehr fasziniert ist der Beat. Ich suche:
    Die Noten für den Beat. Kann mir da jemand helfen und mir die Noten geben.

    Ich lerne eben wie man solche beats selbst kreiert.

    wäre schön wenn ihr mir den link geben könntet.

    mfg
    xasa
    :cool:
  • in: beatmaker 4 mac

    geschrieben von xasa

    Hey leute ich habe mal im forum, antworten auf meine frage gesucht. Leider sind die antworten die ich suchte nur für Windows und nicht für mac os x.

    Ich suche einen kostenlosen guten software, mitdem ich gute hip-hop, techno, electro etc. beats machen kann.
    könnt ihr mir direkt den link geben. Ich wäre sehr dankbar dafür .

    mfg
    xasa
    :cool:
  • in: unendlich

    geschrieben von xasa

    danke für eure meinungen...
  • in: unendlich

    geschrieben von xasa

    wo genau ist dann das "Irgendwo"??????
  • in: unendlich

    geschrieben von xasa

    Ich habe mir mal überlegt, ob mal das Unendliche erreicht werden kann...
    Ich habe mich mit einem Freund darüber unterhalten und wir haben keinen Anhaltspunkt gefunden.
    Die frage die ich nicht beantworten kann ist, wie viel ist sie?
    und wann wird sie erreich? wird sie überhaupt jemals erreicht???
    kann mir mal jemand das philosophisch erklären

    piis

    Beitrag geaendert: 16.4.2007 19:02:22 von xasa
  • in: Mein Handy hat Probleme mit den Cookies

    geschrieben von xasa

    versuch doch mal alle cookies zu löschen und logg dich wieder ein.

    ;)
  • in: nichts

    geschrieben von xasa



    xasa schrieb:
    es müssen mehr leute kommen um nichts zu sagen....die ganze sache ist eine nichtige sache...


    wsa schrieb:
    xasa schrieb:
    ihr seit ja sehr kreativ

    weiter so!! aber ein bisschen mehr text könnte auch nicht schaden!!

    Beitrag geaendert: 4.4.2007 14:19:43 von xasa


    Ja du hast recht man kann ja auch mit Text kreativ sein:biggrin:
    |-^^^^^^^^^^^^^| |-^^^^^^^^^^^^^^^||
    |-----&#9688;&#9688;&#9688;LAST------| |----WAGEN--- &#9688;&#9688;&#9688;&#9688;&#9688;---||'''\___
    |__________________|_|_____________________||__ |_`|
    _____(@)(@)____________(@)(@)(@)_____(@)(@)__(@)


    xasa schrieb:
    ihr seit ja sehr kreativ

    weiter so!! aber ein bisschen mehr text könnte auch nicht schaden!!

    Beitrag geaendert: 4.4.2007 14:19:43 von xasa


    milchreis schrieb:



    Wieso ist 'ist' sofort mit existieren verbunden?

    'ist' ist für mich ein Vergleichsoperator...



    heir muss ich nochmal nachhaken:
    'ist' ist eine gebaugte form des Verbs 'seien' was ja eindeutig mit 'existieren....' vergleichbar ist.

    'sein oder nicht sein...'


    2 plus 3 ist 5...existiert die 5?

    Anscheinend hat 'ist' mehrere Bedeutungen und ich beziehe mich auf die, die zu meiner Argumentation passt :P

    ja toll. (hier gehen auch Farbverläufe^^
    :rolleyes::rolleyes::rolleyes::rolleyes::rolleyes::rolleyes::rolleyes::rolleyes::rolleyes::rolleyes:
    :P:P:P:P:P:P:P:P:P:P
    :biggrin::biggrin::biggrin::biggrin::biggrin::biggrin::biggrin::biggrin::biggrin::biggrin:
    :slant::slant::slant::slant::slant::slant::slant::slant::slant::slant:
    :lol::lol::lol::lol::lol::lol::lol::lol::lol::lol:



    teremy schrieb:
    Wisst ihr was mir so langsam auf den Sack geht? Nichts!


    martix schrieb:
    :biggrin::biggrin::biggrin::biggrin::biggrin::biggrin::biggrin::biggrin:
    :biggrin:;);););););):biggrin:
    :biggrin:;):slant::slant::slant::slant:;):biggrin:
    :biggrin:;):slant::cool::cool::slant:;):biggrin:
    :biggrin:;):slant::slant::slant::slant:;):biggrin:
    :biggrin:;);););););):biggrin:
    :biggrin::biggrin::biggrin::biggrin::biggrin::biggrin::biggrin::biggrin:

    Beitrag geaendert: 4.4.2007 13:42:30 von martix


    wsa schrieb:
    :mad::mad::mad::mad::mad::mad::mad::mad:
    :mad::mad::mad:;) ;) :mad::mad::mad:
    :mad::mad::mad:;) ;) :mad::mad::mad:
    :mad:;);) ;) ;) ;) ;):mad:
    :mad:;);) ;) ;) ;) ;):mad:
    :mad::mad::mad:;) ;) :mad::mad::mad:
    :mad::mad::mad:;) ;) :mad::mad::mad:
    :mad::mad::mad::mad::mad::mad::mad::mad:


    Beitrag geaendert: 4.4.2007 13:34:18 von wsa


    zwiebeldoener schrieb:


    :eek::cool::cool::cool::cool::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::cool::cool::cool::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::cool::cool::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::cool::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::eek::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::eek:

    Das sieht ja stark aus!
    :thumb:

    Es sähe besser aus, wenn nicht sowohl oben links als auch unten rechts :eek: wäre. Dann wäre es nur kein Quadrat mehr


    teremy schrieb:

    :eek::cool::cool::cool::cool::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::cool::cool::cool::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::cool::cool::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::cool::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::eek::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::eek:

    Das sieht ja stark aus!
    :thumb:


    wsa schrieb:
    :eek::cool::cool::cool::cool::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::cool::cool::cool::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::cool::cool::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::cool::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::cool::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::cool::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::cool::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::cool::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::eek::cool::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::cool::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::cool:
    :eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::eek::eek:


    felixbayer schrieb:
    Aha, Ich seh schon euch is langweilig :blah:


    wolfgangmixer schrieb:
    Das ist doch kein Thema.
    Also höchstens ein Nichtthema.


    thoba schrieb:

    was haltet ihr von nichts?

    Ehrlich gesagt halte ich davon nicht sehr viel.


    zwiebeldoener schrieb:


    Wieso ist 'ist' sofort mit existieren verbunden?

    'ist' ist für mich ein Vergleichsoperator...



    heir muss ich nochmal nachhaken:
    'ist' ist eine gebaugte form des Verbs 'seien' was ja eindeutig mit 'existieren....' vergleichbar ist.

    'sein oder nicht sein...'


    2 plus 3 ist 5...existiert die 5?

    Anscheinend hat 'ist' mehrere Bedeutungen und ich beziehe mich auf die, die zu meiner Argumentation passt :P



    milchreis schrieb:

    Bzw. vergiss es, heute ist noch kein derartiger Beweis möglich ;)


    hah, wenn ich erst meinen Antimateriegenerator fertig gebaut hab, dannnnn jaaahaaa.... :biggrin:;)


    Milchreis, ich weiß, dass du ihn mir stehlen willst, also gib's auf :D
  • in: nichts

    geschrieben von xasa

    es müssen mehr leute kommen um nichts zu sagen....die ganze sache ist eine nichtige sache...
  • in: function

    geschrieben von xasa

    ich verstehe jetzt was eine funktion und was ein array ist...alles i.o:lol:
    Dieses thema kann geschlossen werden.:lol::lol::lol::lol::lol:
  • in: Primzahlen

    geschrieben von xasa

    nigolaz schrieb:
    Also wenn du es wirklich einfach machen willst:
    Du versuchst jede Zahl durch jede kleinere Zahl du teilen, wenns nie geht, ist's eine Prim.

    Ist aber ziemlich langsam.

    Könnte irgendwie so aussehen: (Habs nicht ausprobiert)
    <?php
    //Welche Zahlen sollen durchsucht werden:
    $start = 2;
    $ende = 100;
    
    // Eine Schlaufe, die jede Zahl durchsucht:
    for($zahl = $start ;  $zahl <= $ende ;  $zahl ++) {
    
       $prim = true;  //Ich nehme an, es ist eine Primzahl
    
       //Von 2 bis zur Zahl selbst...
       for($teiler = 2 ; $teiler < $zahl ;  $teiler ++) {
      
          //ist i durch j teilbar? Wenn ja, ist der Restwert (%) = 0
          if($zahl % $teiler == 0) {
             $prim = false;  //die Zahl ist keine Prim
             break;          //die 2te Schlaufe beenden
          }
       }
       if($prim)
          echo $zahl;
    }
    
    
    ?>


    Beitrag geaendert: 7.4.2007 11:58:56 von nigolaz


    danke, der code funktioniert.

Login zum Webhosting ohne Werbung!